Jump to content

Recommended Posts

Posted

Without the dots it should look like llanfairpwllgwyngyllgogerychwyrndrobwyll-llantysiliogogogoch.com.

 

This domain name is 59 characters long. it is the longest singleword domain name. The longest domain name is thelongestdomainnameintheworldandthensomeandthensomemoreandmore.com at 63 characters. ICANN has made this the limit, 67 if you add the .ext.

 

Good thing too, I would hate to have to type Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop

nopparatrajathaniburiromudomrajaniwesmahasatharn

amornphimarnavatarnsathitsakkattiyavisanukamprasit.com

Posted
I would hate to have to type Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathanibur

romudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit.com

 

Is that even pronounceable?

 

-Thomas

Posted

Hey, you think

 

"Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajatha

iburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit" is bad?

 

At least it has vowels.

 

Try pronouncing "cvxtlthqwnqplwzcbgwpkmhgmfgrdcsxqt.org" (which may actually exist in central/eastern Europe).

 

(Hint: If you can't pronounce the above, try tuning a radio into that area to the right of all receivable stations; it will pronounce it perfectly. And if it doesn't, who'll ever know?)

Posted

Hmm.

 

I can't seem to get rid of the "&quot" in the foregoing post. My apologies for any confusion.

Posted

Hi,

Guess whats this is, its not a bug its not a hack but can't understand what this is.

However output is very well known in books of people interested in Typography.

 

 

Try this: Open a Word document and TYPE

 

 

 

= rand (200,99)

 

 

 

Press Enter and wait 5 seconds...

 

 

See a,

manu

Posted

Hmm. Perhaps if I spoke Korean or Japanese ....

Join the conversation

You can post now and register later. If you have an account, sign in now to post with your account.

Guest
Unfortunately, your content contains terms that we do not allow. Please edit your content to remove the highlighted words below.
Reply to this topic...

×   Pasted as rich text.   Paste as plain text instead

  Only 75 emoji are allowed.

×   Your link has been automatically embedded.   Display as a link instead

×   Your previous content has been restored.   Clear editor

×   You cannot paste images directly. Upload or insert images from URL.

×
×
  • Create New...